Lineage for d1erjc_ (1erj C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17159Fold b.69: 7-bladed beta-propeller [50964] (7 superfamilies)
  4. 17190Superfamily b.69.4: Trp-Asp repeat (WD-repeat) [50978] (1 family) (S)
  5. 17191Family b.69.4.1: Trp-Asp repeat (WD-repeat) [50979] (2 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 17207Protein Tup1, C-therminal domain [50983] (1 species)
  7. 17208Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50984] (1 PDB entry)
  8. 17211Domain d1erjc_: 1erj C: [27662]

Details for d1erjc_

PDB Entry: 1erj (more details), 2.3 Å

PDB Description: crystal structure of the c-terminal wd40 domain of tup1

SCOP Domain Sequences for d1erjc_:

Sequence, based on SEQRES records: (download)

>d1erjc_ b.69.4.1 (C:) Tup1, C-therminal domain {Baker's yeast (Saccharomyces cerevisiae)}
hylvpynqranhskpippflldldsqsvpdalkkqtndyyilynpalpreidvelhksld
htsvvccvkfsndgeylatgcnkttqvyrvsdgslvarlsddsaankdpenlntssspss
dlyirsvcfspdgkflatgaedrliriwdienrkivmilqgheqdiysldyfpsgdklvs
gsgdrtvriwdlrtgqcsltlsiedgvttvavspgdgkyiaagsldravrvwdsetgflv
erldsenesgtghkdsvysvvftrdgqsvvsgsldrsvklwnlqnannksdsktpnsgtc
evtyighkdfvlsvattqndeyilsgskdrgvlfwdkksgnpllmlqghrnsvisvavan
gsslgpeynvfatgsgdckariwkykki

Sequence, based on observed residues (ATOM records): (download)

>d1erjc_ b.69.4.1 (C:) Tup1, C-therminal domain {Baker's yeast (Saccharomyces cerevisiae)}
hylvpynqranhskpippflldldsqsvpdalkkqtndyyilynpalpreidvelhksld
htsvvccvkfsndgeylatgcnkttqvyrvsdgslvarlsddsdlyirsvcfspdgkfla
tgaedrliriwdienrkivmilqgheqdiysldyfpsgdklvsgsgdrtvriwdlrtgqc
sltlsiedgvttvavspgdgkyiaagsldravrvwdsetgflverldsenesgtghkdsv
ysvvftrdgqsvvsgsldrsvklwnlqtcevtyighkdfvlsvattqndeyilsgskdrg
vlfwdkksgnpllmlqghrnsvisvavangsslgpeynvfatgsgdckariwkykki

SCOP Domain Coordinates for d1erjc_:

Click to download the PDB-style file with coordinates for d1erjc_.
(The format of our PDB-style files is described here.)

Timeline for d1erjc_: