SCOPe 2.07: Domain d4zgyb_: 4zgy B:

Lineage for d4zgyb_ (4zgy B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.7: Ornithine decarboxylase antizyme-like [143714] (2 proteins)
   Pfam PF02100; may have evolved different function; putative active site maps to the same location in the common fold

6. Protein automated matches [276615] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [276616] (1 PDB entry)

8. Domain d4zgyb_: 4zgy B: [276617]
   automated match to d1zo0a1
   complexed with mg, plp

Details for d4zgyb_

PDB Entry: 4zgy, 2.63 Å

PDB Description: structure of human ornithine decarboxylase in complex with a c- terminal fragment of antizyme

PDB Compounds: (B:) Ornithine decarboxylase antizyme 1

SCOPe Domain Sequences for d4zgyb_:

Sequence; same for both SEQRES and ATOM records:

>d4zgyb_ d.108.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fysddrlnvteeltsndktrilnvqsrltdakrinwrtvlsggslyieipggalpegskd
sfavllefaeeqlradhvficfhknredraallrtfsflgfeivrpghplvpkrpdacfm
aytfe

Timeline for d4zgyb_:

• d4zgyb_ first appeared in SCOPe 2.05
  
• d4zgyb_ appears in SCOPe 2.06
  
• d4zgyb_ appears in the current release, SCOPe 2.08