Lineage for d4zgyb_ (4zgy B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209712Family d.108.1.7: Ornithine decarboxylase antizyme-like [143714] (2 proteins)
    Pfam PF02100; may have evolved different function; putative active site maps to the same location in the common fold
  6. 2209716Protein automated matches [276615] (1 species)
    not a true protein
  7. 2209717Species Human (Homo sapiens) [TaxId:9606] [276616] (1 PDB entry)
  8. 2209718Domain d4zgyb_: 4zgy B: [276617]
    automated match to d1zo0a1
    complexed with mg, plp

Details for d4zgyb_

PDB Entry: 4zgy (more details), 2.63 Å

PDB Description: structure of human ornithine decarboxylase in complex with a c- terminal fragment of antizyme
PDB Compounds: (B:) Ornithine decarboxylase antizyme 1

SCOPe Domain Sequences for d4zgyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zgyb_ d.108.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fysddrlnvteeltsndktrilnvqsrltdakrinwrtvlsggslyieipggalpegskd
sfavllefaeeqlradhvficfhknredraallrtfsflgfeivrpghplvpkrpdacfm
aytfe

SCOPe Domain Coordinates for d4zgyb_:

Click to download the PDB-style file with coordinates for d4zgyb_.
(The format of our PDB-style files is described here.)

Timeline for d4zgyb_: