![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.103.1: Citrate synthase [48256] (2 families) ![]() |
![]() | Family a.103.1.1: Citrate synthase [48257] (2 proteins) duplication: large domain consists of two structural repeats the second repeat is interrupted by the small domain automatically mapped to Pfam PF00285 |
![]() | Protein automated matches [190675] (10 species) not a true protein |
![]() | Species Thermoplasma acidophilum [TaxId:273075] [276610] (1 PDB entry) |
![]() | Domain d4ybod1: 4ybo D:3-384 [276613] Other proteins in same PDB: d4yboa2, d4ybod2 automated match to d2ifcc_ complexed with bct |
PDB Entry: 4ybo (more details), 2.18 Å
SCOPe Domain Sequences for d4ybod1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ybod1 a.103.1.1 (D:3-384) automated matches {Thermoplasma acidophilum [TaxId: 273075]} teeiskgledvnikwtrlttidgnkgilryggysvediiasgaqdeeiqylflygnlpte qelrkyketvqkgykipdfvinairqlpresdavamqmaavaamaasetkfkwnkdtdrd vaaemigrmsaitvnvyrhimnmpaelpkpsdsyaesflnaafgrkatkeeidamntali lytdhevpasttaglvavstlsdmysgitaalaalkgplhggaaeaaiaqfdeikdpamv ekwfndniingkkrlmgfghrvyktydprakifkgiaeklsskkpevhkvyeiatkledf gikafgskgiypntdyfsgivymsigfplrnniytalfalsrvtgwqahfieyveeqqrl irpravyvgpaerkyvpiaerk
Timeline for d4ybod1:
![]() Domains from other chains: (mouse over for more information) d4yboa1, d4yboa2, d4ybob_, d4yboc_ |