SCOPe 2.06: Domain d4yboa1: 4ybo A:5-384

Lineage for d4yboa1 (4ybo A:5-384)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.103: Citrate synthase [48255] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.103.1: Citrate synthase [48256] (2 families)

5. Family a.103.1.1: Citrate synthase [48257] (2 proteins)
   duplication: large domain consists of two structural repeats
   the second repeat is interrupted by the small domain
   automatically mapped to Pfam PF00285

6. Protein automated matches [190675] (7 species)
   not a true protein

7. Species Thermoplasma acidophilum [TaxId:273075] [276610] (1 PDB entry)

8. Domain d4yboa1: 4ybo A:5-384 [276611]
   Other proteins in same PDB: d4yboa2, d4ybod2
   automated match to d2ifcc_
   complexed with bct

Details for d4yboa1

PDB Entry: 4ybo, 2.18 Å

PDB Description: structure of citrate synthase from the thermoacidophilic euryarchaeon thermolasma acidophilum

PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d4yboa1:

Sequence; same for both SEQRES and ATOM records:

>d4yboa1 a.103.1.1 (A:5-384) automated matches {Thermoplasma acidophilum [TaxId: 273075]}
eiskgledvnikwtrlttidgnkgilryggysvediiasgaqdeeiqylflygnlpteqe
lrkyketvqkgykipdfvinairqlpresdavamqmaavaamaasetkfkwnkdtdrdva
aemigrmsaitvnvyrhimnmpaelpkpsdsyaesflnaafgrkatkeeidamntalily
tdhevpasttaglvavstlsdmysgitaalaalkgplhggaaeaaiaqfdeikdpamvek
wfndniingkkrlmgfghrvyktydprakifkgiaeklsskkpevhkvyeiatkledfgi
kafgskgiypntdyfsgivymsigfplrnniytalfalsrvtgwqahfieyveeqqrlir
pravyvgpaerkyvpiaerk

Timeline for d4yboa1:

• d4yboa1 first appeared in SCOPe 2.05, called d4yboa_
  
• d4yboa1 appears in SCOPe 2.07
  
• d4yboa1 appears in the current release, SCOPe 2.08