Lineage for d1erjb_ (1erj B:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 301939Fold b.69: 7-bladed beta-propeller [50964] (10 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 301999Superfamily b.69.4: WD40-repeat [50978] (1 family) (S)
    also contains 8-bladed propellers
  5. 302000Family b.69.4.1: WD40-repeat [50979] (7 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 302042Protein Tup1, C-terminal domain [50983] (1 species)
  7. 302043Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50984] (1 PDB entry)
  8. 302045Domain d1erjb_: 1erj B: [27661]

Details for d1erjb_

PDB Entry: 1erj (more details), 2.3 Å

PDB Description: crystal structure of the c-terminal wd40 domain of tup1

SCOP Domain Sequences for d1erjb_:

Sequence, based on SEQRES records: (download)

>d1erjb_ b.69.4.1 (B:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
hylvpynqranhskpippflldldsqsvpdalkkqtndyyilynpalpreidvelhksld
htsvvccvkfsndgeylatgcnkttqvyrvsdgslvarlsddsaankdpenlntssspss
dlyirsvcfspdgkflatgaedrliriwdienrkivmilqgheqdiysldyfpsgdklvs
gsgdrtvriwdlrtgqcsltlsiedgvttvavspgdgkyiaagsldravrvwdsetgflv
erldsenesgtghkdsvysvvftrdgqsvvsgsldrsvklwnlqnannksdsktpnsgtc
evtyighkdfvlsvattqndeyilsgskdrgvlfwdkksgnpllmlqghrnsvisvavan
gsslgpeynvfatgsgdckariwkykki

Sequence, based on observed residues (ATOM records): (download)

>d1erjb_ b.69.4.1 (B:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
hylvpynqranhskpippflldldsqsvpdalkkqtndyyilynpalpreidvelhksld
htsvvccvkfsndgeylatgcnkttqvyrvsdgslvarlsddlyirsvcfspdgkflatg
aedrliriwdienrkivmilqgheqdiysldyfpsgdklvsgsgdrtvriwdlrtgqcsl
tlsiedgvttvavspgdgkyiaagsldravrvwdsetgflverldtghkdsvysvvftrd
gqsvvsgsldrsvklwnltcevtyighkdfvlsvattqndeyilsgskdrgvlfwdkksg
npllmlqghrnsvisvavangsslgpeynvfatgsgdckariwkykki

SCOP Domain Coordinates for d1erjb_:

Click to download the PDB-style file with coordinates for d1erjb_.
(The format of our PDB-style files is described here.)

Timeline for d1erjb_: