SCOPe 2.08: Domain d4uwca_: 4uwc A:

Lineage for d4uwca_ (4uwc A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Fibroblast growth factor receptor 1 [56158] (1 species)
   PTK group; FGFR subfamily; membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56159] (47 PDB entries)

8. Domain d4uwca_: 4uwc A: [276608]
   automated match to d4v04b_
   complexed with 4y0, edo, ppi, so4

Details for d4uwca_

PDB Entry: 4uwc, 1.96 Å

PDB Description: fibroblast growth factor receptor 1 kinase in complex with jk-p3

PDB Compounds: (A:) fibroblast growth factor receptor 1

SCOPe Domain Sequences for d4uwca_:

Sequence; same for both SEQRES and ATOM records:

>d4uwca_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
lpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatekd
lsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgleys
ynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfgl
ardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgv
pveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnq
e

Timeline for d4uwca_:

• d4uwca_ first appeared in SCOPe 2.05
  
• d4uwca_ appears in SCOPe 2.07