SCOPe 2.06: Domain d3wr7b_: 3wr7 B:

Lineage for d3wr7b_ (3wr7 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (42 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [260781] (2 PDB entries)

8. Domain d3wr7b_: 3wr7 B: [276606]
   automated match to d4r9mc_
   complexed with coa, spd

Details for d3wr7b_

PDB Entry: 3wr7, 2.5 Å

PDB Description: crystal structure of spermidine acetyltransferase from escherichia coli

PDB Compounds: (B:) Spermidine n1-acetyltransferase

SCOPe Domain Sequences for d3wr7b_:

Sequence; same for both SEQRES and ATOM records:

>d3wr7b_ d.108.1.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
hsvklrpleredlryvhqldnnasvmrywfeepyeafvelsdlydkhihdqserrfvvec
dgekaglvelveinhvhrraefqiiispeyqgkglatraaklamdygftvlnlyklyliv
dkenekaihiyrklgfsvegelmheffingqyrnairmcifqhqylaehk

Timeline for d3wr7b_:

• d3wr7b_ first appeared in SCOPe 2.05
  
• d3wr7b_ appears in SCOPe 2.07
  
• d3wr7b_ appears in the current release, SCOPe 2.08