| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins) |
| Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47553] (10 PDB entries) |
| Domain d4wq2a_: 4wq2 A: [276602] automated match to d1kfxs_ complexed with 3su, ca, edo |
PDB Entry: 4wq2 (more details), 1.64 Å
SCOPe Domain Sequences for d4wq2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wq2a_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Human (Homo sapiens) [TaxId: 9606]}
eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikrwqaiykqfdtdrsgticsselpgafeaagfhlnehlynmiir
rysdesgnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys
Timeline for d4wq2a_: