Lineage for d1erja_ (1erj A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065971Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2065972Family b.69.4.1: WD40-repeat [50979] (13 protein domains)
  6. 2066068Protein Tup1, C-terminal domain [50983] (1 species)
  7. 2066069Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50984] (1 PDB entry)
  8. 2066070Domain d1erja_: 1erj A: [27660]

Details for d1erja_

PDB Entry: 1erj (more details), 2.3 Å

PDB Description: crystal structure of the c-terminal wd40 domain of tup1
PDB Compounds: (A:) transcriptional repressor tup1

SCOPe Domain Sequences for d1erja_:

Sequence, based on SEQRES records: (download)

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hylvpynqranhskpippflldldsqsvpdalkkqtndyyilynpalpreidvelhksld
htsvvccvkfsndgeylatgcnkttqvyrvsdgslvarlsddsaankdpenlntssspss
dlyirsvcfspdgkflatgaedrliriwdienrkivmilqgheqdiysldyfpsgdklvs
gsgdrtvriwdlrtgqcsltlsiedgvttvavspgdgkyiaagsldravrvwdsetgflv
erldsenesgtghkdsvysvvftrdgqsvvsgsldrsvklwnlqnannksdsktpnsgtc
evtyighkdfvlsvattqndeyilsgskdrgvlfwdkksgnpllmlqghrnsvisvavan
gsslgpeynvfatgsgdckariwkykki

Sequence, based on observed residues (ATOM records): (download)

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hylvpynqranhskpippflldldsqsvpdalkkqtndyyilynpalpreidvelhksld
htsvvccvkfsndgeylatgcnkttqvyrvsdgslvarlsdssdlyirsvcfspdgkfla
tgaedrliriwdienrkivmilqgheqdiysldyfpsgdklvsgsgdrtvriwdlrtgqc
sltlsiedgvttvavspgdgkyiaagsldravrvwdsetgflverldtghkdsvysvvft
rdgqsvvsgsldrsvklwnltcevtyighkdfvlsvattqndeyilsgskdrgvlfwdkk
sgnpllmlqghrnsvisvavangsslgpeynvfatgsgdckariwkykki

SCOPe Domain Coordinates for d1erja_:

Click to download the PDB-style file with coordinates for d1erja_.
(The format of our PDB-style files is described here.)

Timeline for d1erja_: