Lineage for d4wp9b_ (4wp9 B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) 
common fold is elaborated with additional secondary structures
Family d.58.29.0: automated matches [191671] (1 protein)
not a true familyProtein automated matches [191274] (8 species)
not a true protein
Species Mycobacterium avium [TaxId:1764] [276597] (1 PDB entry) 
Domain d4wp9b_: 4wp9 B: [276598]
automated match to d2w01c_
complexed with ca, mg, zda
Details for d4wp9b_
PDB Entry: 4wp9 (more details), 1.38 Å
PDB Description: crystal structure of adenylyl cyclase ma1120 from mycobacterium avium bound to 2'5'-dd-3'-atp, calcium and magnesium ion
PDB Compounds: (B:) Ma1120SCOPe Domain Sequences for d4wp9b_:
Sequence, based on SEQRES records: (download)
>d4wp9b_ d.58.29.0 (B:) automated matches {Mycobacterium avium [TaxId: 1764]}
amgsrvvilftdieestalnerigdrawvklisshdklvsdlvrrqsghvvksqgdgfmv
afarpeqavrcgielqralrrnanrkrheeirvrigihmgrsvrrgddlfgrnvamaarv
aaqaaggeilvsqpvrdalsrsdgirfddgrevelkgfsgtyrlfavl
Sequence, based on observed residues (ATOM records): (download)
>d4wp9b_ d.58.29.0 (B:) automated matches {Mycobacterium avium [TaxId: 1764]}
amgsrvvilftdieestalnerigdrawvklisshdklvsdlvrrqsghvvksqgdgfmv
afarpeqavrcgielqralrreirvrigihmgrsvrrgddlfgrnvamaarvaaqaagge
ilvsqpvrdalsrsdgirfddgrevelkgfsgtyrlfavl
SCOPe Domain Coordinates for d4wp9b_:
Click to download the PDB-style file with coordinates for d4wp9b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4wp9b_:
- d4wp9b_ is new in SCOPe 2.05-stable
- d4wp9b_ is called d4wp9b1 in SCOPe 2.06
- d4wp9b_ appears in the current release, SCOPe 2.08, called d4wp9b1
View in 3D
