Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Mus musculus [TaxId:10090] [272437] (43 PDB entries) |
Domain d4uimd1: 4uim D:1-107 [276587] Other proteins in same PDB: d4uimb2, d4uimd2, d4uimf2, d4uiml2 automated match to d2v7ha1 complexed with so4 |
PDB Entry: 4uim (more details), 2.7 Å
SCOPe Domain Sequences for d4uimd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uimd1 b.1.1.0 (D:1-107) automated matches {Mus musculus [TaxId: 10090]} diqmtqttsslsaslgdrvtiscrasqdisnyltwyqqkpdgtvklliyytsklhsgvps rfsgsgsgtdysltisnleqedvanyfcqqgnslpptfgggtkleik
Timeline for d4uimd1: