| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d4uimf1: 4uim F:1-107 [276583] Other proteins in same PDB: d4uima_, d4uimb2, d4uimc_, d4uimd2, d4uime_, d4uimf2, d4uimh_, d4uiml2 automated match to d2v7ha1 complexed with so4 |
PDB Entry: 4uim (more details), 2.7 Å
SCOPe Domain Sequences for d4uimf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uimf1 b.1.1.0 (F:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqttsslsaslgdrvtiscrasqdisnyltwyqqkpdgtvklliyytsklhsgvps
rfsgsgsgtdysltisnleqedvanyfcqqgnslpptfgggtkleik
Timeline for d4uimf1: