SCOP 1.71: Domain d1a0rb_: 1a0r B:

Lineage for d1a0rb_ (1a0r B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.4: WD40 repeat-like [50978] (2 families)
   also contains 8-bladed propellers

5. Family b.69.4.1: WD40-repeat [50979] (8 proteins)
   this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain

6. Protein beta1-subunit of the signal-transducing G protein heterotrimer [50980] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50981] (9 PDB entries)

8. Domain d1a0rb_: 1a0r B: [27658]
   Other proteins in same PDB: d1a0rg_, d1a0rp_
   complexed with ace, far

Details for d1a0rb_

PDB Entry: 1a0r, 2.8 Å

PDB Description: heterotrimeric complex of phosducin/transducin beta-gamma

SCOP Domain Sequences for d1a0rb_:

Sequence; same for both SEQRES and ATOM records:

>d1a0rb_ b.69.4.1 (B:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus)}
seldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiyam
hwgtdsrlllsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldnic
siynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttft
ghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngnaf
atgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdalk
adragvlaghdnrvsclgvtddgmavatgswdsflkiwn

Timeline for d1a0rb_:

• d1a0rb_ first appeared (with stable ids) in SCOP 1.55
  
• d1a0rb_ appears in SCOP 1.69
  
• d1a0rb_ appears in SCOP 1.73
  
• d1a0rb_ appears in the current release, SCOPe 2.08