Lineage for d4u74a_ (4u74 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016335Fold a.266: Indolic compounds 2,3-dioxygenase-like [140958] (1 superfamily)
    multihelical; bundle, contains interrupted helices
  4. 2016336Superfamily a.266.1: Indolic compounds 2,3-dioxygenase-like [140959] (3 families) (S)
    contains heme-dependent enzymes
  5. 2016346Family a.266.1.2: Indoleamine 2,3-dioxygenase-like [140963] (3 protein domains)
    Pfam PF01231; contains extra N-terminal all-alpha subdomain of similar fold to the GST C-terminal domain (47615)
  6. 2016356Protein automated matches [190585] (2 species)
    not a true protein
  7. 2016357Species Human (Homo sapiens) [TaxId:9606] [187592] (8 PDB entries)
  8. 2016363Domain d4u74a_: 4u74 A: [276579]
    automated match to d2d0tb_
    complexed with hem, nhe, pim; mutant

Details for d4u74a_

PDB Entry: 4u74 (more details), 2.31 Å

PDB Description: crystal structure of 4-phenylimidazole bound form of human indoleamine 2,3-dioxygenase (g262a mutant)
PDB Compounds: (A:) Indoleamine 2,3-dioxygenase 1

SCOPe Domain Sequences for d4u74a_:

Sequence, based on SEQRES records: (download)

>d4u74a_ a.266.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhlt
dhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadcvl
anwkkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamqmq
erdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvyeg
fwedpkefagasagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcsle
snpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqqpkenktsedp
skleakgtggtdlmnflktvrstteksllkeg

Sequence, based on observed residues (ATOM records): (download)

>d4u74a_ a.266.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhlt
dhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadcvl
anwkkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamqmq
erdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvyeg
fwedpkefagasagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcsle
snpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqqpggtdlmnfl
ktvrstteksllkeg

SCOPe Domain Coordinates for d4u74a_:

Click to download the PDB-style file with coordinates for d4u74a_.
(The format of our PDB-style files is described here.)

Timeline for d4u74a_: