Lineage for d4r8da_ (4r8d A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132753Species Mycobacterium tuberculosis [TaxId:83332] [187938] (7 PDB entries)
  8. 2132766Domain d4r8da_: 4r8d A: [276574]
    automated match to d3cq5a_
    complexed with mes, plp, so4

Details for d4r8da_

PDB Entry: 4r8d (more details), 2.05 Å

PDB Description: crystal structure of rv1600 encoded aminotransferase in complex with plp-mes from mycobacterium tuberculosis
PDB Compounds: (A:) Histidinol-phosphate aminotransferase

SCOPe Domain Sequences for d4r8da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r8da_ c.67.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ghpvtlddlplradlrgkapygapqlavpvrlntnenphpptralvddvvrsvreaaidl
hrypdrdavalradlagyltaqtgiqlgveniwaangsneilqqllqafggpgrsaigfv
psysmhpiisdgthtewieasrandfgldvdvavaavvdrkpdvvfiaspnnpsgqsvsl
pdlcklldvapgiaivdeaygefssqpsavslveeypsklvvtrtmskafafaggrlgyl
iatpavidamllvrlpyhlssvtqaaaraalrhsddtlssvaaliaerervttslndmgf
rvipsdanfvlfgefadapaawrryleagilirdvgipgylrattglaeendaflrasar
iatdlvpvt

SCOPe Domain Coordinates for d4r8da_:

Click to download the PDB-style file with coordinates for d4r8da_.
(The format of our PDB-style files is described here.)

Timeline for d4r8da_: