Lineage for d4r62a_ (4r62 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183821Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2183822Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2183823Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2184040Protein automated matches [190124] (12 species)
    not a true protein
  7. 2184045Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [197196] (4 PDB entries)
  8. 2184047Domain d4r62a_: 4r62 A: [276572]
    Other proteins in same PDB: d4r62b1, d4r62b2
    automated match to d1ayza_
    complexed with act

Details for d4r62a_

PDB Entry: 4r62 (more details), 2.28 Å

PDB Description: structure of rad6~ub
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 2

SCOPe Domain Sequences for d4r62a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r62a_ d.20.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
stparrrlmrdfkrmkedappgvsasplpdnvmvwnamiigpadtpyedgtfrlllefde
eypnkpphvkflsemfhpnvyangeikldilqnrwtptydvasiltsiqslfndpnpasp
anveaatlfkdhksqyvkrvketvekswe

SCOPe Domain Coordinates for d4r62a_:

Click to download the PDB-style file with coordinates for d4r62a_.
(The format of our PDB-style files is described here.)

Timeline for d4r62a_: