Lineage for d1b9ya_ (1b9y A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. Family b.69.4.1: WD40-repeat [50979] (17 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. Protein beta1-subunit of the signal-transducing G protein heterotrimer [50980] (1 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [50981] (64 PDB entries)
  8. Domain d1b9ya_: 1b9y A: [27656]
    Other proteins in same PDB: d1b9yb_, d1b9yc_
    complexed with gd
    has additional insertions and/or extensions that are not grouped together

Details for d1b9ya_

PDB Entry: 1b9y (more details), 3 Å

PDB Description: structural analysis of phosducin and its phosphorylation-regulated interaction with transducin beta-gamma
PDB Compounds: (A:) protein (transducin)

SCOPe Domain Sequences for d1b9ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b9ya_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}
mseldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiya
mhwgtdsrlllsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldni
csiynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttf
tghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngna
fatgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdal
kadragvlaghdnrvsclgvtddgmavatgswdsflkiwn

SCOPe Domain Coordinates for d1b9ya_ are not available.

Timeline for d1b9ya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b9yb_, d1b9yc_