SCOPe 2.05: Domain d5d9ua1: 5d9u A:2-136

Lineage for d5d9ua1 (5d9u A:2-136)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families)

5. Family d.79.4.0: automated matches [227181] (1 protein)
   not a true family

6. Protein automated matches [226901] (8 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [276302] (3 PDB entries)

8. Domain d5d9ua1: 5d9u A:2-136 [276558]
   Other proteins in same PDB: d5d9ua2, d5d9ub2
   automated match to d3mcqa1
   complexed with adp, mg, na, tpp

Details for d5d9ua1

PDB Entry: 5d9u, 1.9 Å

PDB Description: structure of thiamine-monophosphate kinase from acinetobacter baumannii in complex with adenosine diphosphate (adp) and thiamine diphosphate (tpp), orthorhombic crystal form

PDB Compounds: (A:) Thiamine-monophosphate kinase

SCOPe Domain Sequences for d5d9ua1:

Sequence; same for both SEQRES and ATOM records:

>d5d9ua1 d.79.4.0 (A:2-136) automated matches {Acinetobacter baumannii [TaxId: 470]}
aefsiidqyfnrqshpdvalgigddsalitpppnqqlvicadtlvagrhfpletsphaig
wksvavnlsdiaamgakphsillaislpqvdhewlegfsqgiydccnqfgvaliggdttq
gphltitvtamgwie

Timeline for d5d9ua1:

• d5d9ua1 is new in SCOPe 2.05-stable
  
• d5d9ua1 appears in SCOPe 2.06
  
• d5d9ua1 appears in the current release, SCOPe 2.08