SCOPe 2.08: Domain d5d66a2: 5d66 A:137-236

Lineage for d5d66a2 (5d66 A:137-236)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.0: automated matches [191667] (1 protein)
   not a true family

6. Protein automated matches [191267] (8 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:509173] [276553] (1 PDB entry)

8. Domain d5d66a2: 5d66 A:137-236 [276555]
   automated match to d2l6ba_
   complexed with cl

Details for d5d66a2

PDB Entry: 5d66, 1 Å

PDB Description: crystal structure of an ankyrin repeat domain (abaye2397) from acinetobacter baumannii aye at 1.00 a resolution

PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d5d66a2:

Sequence; same for both SEQRES and ATOM records:

>d5d66a2 d.211.1.0 (A:137-236) automated matches {Acinetobacter baumannii [TaxId: 509173]}
nryggtalipaaerghvetvrtliaagvnvnhvnnlgwtalleaiilgngksnyqqival
llkaganpnladkdgitplqhartrgyreieklllvagak

Timeline for d5d66a2:

• d5d66a2 first appeared in SCOPe 2.05
  
• d5d66a2 appears in SCOPe 2.07