SCOPe 2.08: Domain d5d67a1: 5d67 A:1008-1092

Lineage for d5d67a1 (5d67 A:1008-1092)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins)

6. Protein automated matches [190808] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188079] (3 PDB entries)

8. Domain d5d67a1: 5d67 A:1008-1092 [276552]
   Other proteins in same PDB: d5d67a2, d5d67b2, d5d67c2
   automated match to d1wlza1
   complexed with so4

Details for d5d67a1

PDB Entry: 5d67, 2 Å

PDB Description: crystal structure of an ef-hand calcium binding domain of cap-binding protein complex-interacting protein 1 (efcab6) from homo sapiens at 2.00 a resolution

PDB Compounds: (A:) EF-hand calcium-binding domain-containing protein 6

SCOPe Domain Sequences for d5d67a1:

Sequence; same for both SEQRES and ATOM records:

>d5d67a1 a.39.1.7 (A:1008-1092) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltdeqfgr
lwnempvnakgrlkypdflsrfsse

Timeline for d5d67a1:

• d5d67a1 first appeared in SCOPe 2.05, called d5d67a_
  
• d5d67a1 appears in SCOPe 2.07