Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins) |
Protein automated matches [190808] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188079] (2 PDB entries) |
Domain d5d67c1: 5d67 C:1008-1091 [276551] Other proteins in same PDB: d5d67a2, d5d67b2, d5d67c2 automated match to d1wlza1 complexed with so4 |
PDB Entry: 5d67 (more details), 2 Å
SCOPe Domain Sequences for d5d67c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d67c1 a.39.1.7 (C:1008-1091) automated matches {Human (Homo sapiens) [TaxId: 9606]} atadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltdeqfgr lwnempvnakgrlkypdflsrfss
Timeline for d5d67c1: