Lineage for d5d67c1 (5d67 C:1008-1091)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711389Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins)
  6. 2711457Protein automated matches [190808] (1 species)
    not a true protein
  7. 2711458Species Human (Homo sapiens) [TaxId:9606] [188079] (3 PDB entries)
  8. 2711464Domain d5d67c1: 5d67 C:1008-1091 [276551]
    Other proteins in same PDB: d5d67a2, d5d67b2, d5d67c2
    automated match to d1wlza1
    complexed with so4

Details for d5d67c1

PDB Entry: 5d67 (more details), 2 Å

PDB Description: crystal structure of an ef-hand calcium binding domain of cap-binding protein complex-interacting protein 1 (efcab6) from homo sapiens at 2.00 a resolution
PDB Compounds: (C:) EF-hand calcium-binding domain-containing protein 6

SCOPe Domain Sequences for d5d67c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d67c1 a.39.1.7 (C:1008-1091) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltdeqfgr
lwnempvnakgrlkypdflsrfss

SCOPe Domain Coordinates for d5d67c1:

Click to download the PDB-style file with coordinates for d5d67c1.
(The format of our PDB-style files is described here.)

Timeline for d5d67c1: