SCOPe 2.08: Domain d5d69a_: 5d69 A:

Lineage for d5d69a_ (5d69 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)

6. Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47553] (10 PDB entries)

8. Domain d5d69a_: 5d69 A: [276547]
   automated match to d1kfxs_
   complexed with 57t, ca, so4

Details for d5d69a_

PDB Entry: 5d69, 1.97 Å

PDB Description: human calpain pef(s) with (2z,2z')-2,2'-disulfanediylbis(3-(6- iodoindol-3-yl)acrylic acid) bound

PDB Compounds: (A:) Calpain small subunit 1

SCOPe Domain Sequences for d5d69a_:

Sequence; same for both SEQRES and ATOM records:

>d5d69a_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Human (Homo sapiens) [TaxId: 9606]}
eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikrwqaiykqfdtdrsgticsselpgafeaagfhlnehlynmiir
rysdesgnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys

Timeline for d5d69a_:

• d5d69a_ first appeared in SCOPe 2.05
  
• d5d69a_ appears in SCOPe 2.07