Lineage for d5d69a_ (5d69 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711466Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)
  6. 2711480Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)
  7. 2711481Species Human (Homo sapiens) [TaxId:9606] [47553] (10 PDB entries)
  8. 2711488Domain d5d69a_: 5d69 A: [276547]
    automated match to d1kfxs_
    complexed with 57t, ca, so4

Details for d5d69a_

PDB Entry: 5d69 (more details), 1.97 Å

PDB Description: human calpain pef(s) with (2z,2z')-2,2'-disulfanediylbis(3-(6- iodoindol-3-yl)acrylic acid) bound
PDB Compounds: (A:) Calpain small subunit 1

SCOPe Domain Sequences for d5d69a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d69a_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Human (Homo sapiens) [TaxId: 9606]}
eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikrwqaiykqfdtdrsgticsselpgafeaagfhlnehlynmiir
rysdesgnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys

SCOPe Domain Coordinates for d5d69a_:

Click to download the PDB-style file with coordinates for d5d69a_.
(The format of our PDB-style files is described here.)

Timeline for d5d69a_: