SCOPe 2.07: Domain d5cjhb2: 5cjh B:476-783

Lineage for d5cjhb2 (5cjh B:476-783)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.0: automated matches [191605] (1 protein)
   not a true family

6. Protein automated matches [191104] (14 species)
   not a true protein

7. Species Magnaporthe oryzae [TaxId:242507] [226424] (5 PDB entries)

8. Domain d5cjhb2: 5cjh B:476-783 [276539]
   automated match to d3ut2a2
   complexed with 522, oh

Details for d5cjhb2

PDB Entry: 5cjh, 1.6 Å

PDB Description: crystal structure of eukaryotic oxoiron magkatg2 at ph 8.5

PDB Compounds: (B:) Catalase-peroxidase 2

SCOPe Domain Sequences for d5cjhb2:

Sequence; same for both SEQRES and ATOM records:

>d5cjhb2 a.93.1.0 (B:476-783) automated matches {Magnaporthe oryzae [TaxId: 242507]}
kesfiwqdplparegdliddadvdklkaailstdgldvsklastamacattyrnsdkrgg
cngarialepqrnwvsnnptqlsavldalkkvqsdfngsngnkkvsladlivlggtaave
kaakdagvdikvpfsagrvdatqeqtdvtqfsylepqadgfrnygrgtararteeimvdk
asqltltppeltvlvggmralganydgsdvgvftankgkltpdffvnlvdmniawtasga
dgeswvgtdrksrsekykgsradlvfgshaelraiaevyaengnqekfvkdfvaawtkvm
nldrfdlk

Timeline for d5cjhb2:

• d5cjhb2 first appeared in SCOPe 2.05
  
• d5cjhb2 appears in SCOPe 2.06
  
• d5cjhb2 appears in the current release, SCOPe 2.08