Lineage for d5cjhb2 (5cjh B:476-783)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2720706Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2720707Protein automated matches [191104] (14 species)
    not a true protein
  7. 2720778Species Magnaporthe oryzae [TaxId:242507] [226424] (5 PDB entries)
  8. 2720794Domain d5cjhb2: 5cjh B:476-783 [276539]
    automated match to d3ut2a2
    complexed with 522, oh

Details for d5cjhb2

PDB Entry: 5cjh (more details), 1.6 Å

PDB Description: crystal structure of eukaryotic oxoiron magkatg2 at ph 8.5
PDB Compounds: (B:) Catalase-peroxidase 2

SCOPe Domain Sequences for d5cjhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cjhb2 a.93.1.0 (B:476-783) automated matches {Magnaporthe oryzae [TaxId: 242507]}
kesfiwqdplparegdliddadvdklkaailstdgldvsklastamacattyrnsdkrgg
cngarialepqrnwvsnnptqlsavldalkkvqsdfngsngnkkvsladlivlggtaave
kaakdagvdikvpfsagrvdatqeqtdvtqfsylepqadgfrnygrgtararteeimvdk
asqltltppeltvlvggmralganydgsdvgvftankgkltpdffvnlvdmniawtasga
dgeswvgtdrksrsekykgsradlvfgshaelraiaevyaengnqekfvkdfvaawtkvm
nldrfdlk

SCOPe Domain Coordinates for d5cjhb2:

Click to download the PDB-style file with coordinates for d5cjhb2.
(The format of our PDB-style files is described here.)

Timeline for d5cjhb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5cjhb1