Class b: All beta proteins [48724] (144 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (13 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.4: WD40 repeat-like [50978] (2 families) also contains 8-bladed propellers |
Family b.69.4.1: WD40-repeat [50979] (8 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
Protein beta1-subunit of the signal-transducing G protein heterotrimer [50980] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [50981] (9 PDB entries) |
Domain d2trcb_: 2trc B: [27653] Other proteins in same PDB: d2trcg_, d2trcp_ |
PDB Entry: 2trc (more details), 2.4 Å
SCOP Domain Sequences for d2trcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2trcb_ b.69.4.1 (B:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus)} mseldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiya mhwgtdsrlllsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldni csiynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttf tghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngna fatgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdal kadragvlaghdnrvsclgvtddgmavatgswdsflkiwn
Timeline for d2trcb_: