Class b: All beta proteins [48724] (104 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (7 superfamilies) |
Superfamily b.69.4: Trp-Asp repeat (WD-repeat) [50978] (1 family) |
Family b.69.4.1: Trp-Asp repeat (WD-repeat) [50979] (2 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
Protein beta1-subunit of the signal-transducing G protein heterotrimer [50980] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [50981] (8 PDB entries) |
Domain d2trcb_: 2trc B: [27653] Other proteins in same PDB: d2trcg_, d2trcp_ |
PDB Entry: 2trc (more details), 2.4 Å
SCOP Domain Sequences for d2trcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2trcb_ b.69.4.1 (B:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus)} mseldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiya mhwgtdsrlllsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldni csiynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttf tghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngna fatgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdal kadragvlaghdnrvsclgvtddgmavatgswdsflkiwn
Timeline for d2trcb_: