Lineage for d2trcb_ (2trc B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62854Fold b.69: 7-bladed beta-propeller [50964] (7 superfamilies)
  4. 62890Superfamily b.69.4: Trp-Asp repeat (WD-repeat) [50978] (1 family) (S)
  5. 62891Family b.69.4.1: Trp-Asp repeat (WD-repeat) [50979] (2 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 62892Protein beta1-subunit of the signal-transducing G protein heterotrimer [50980] (2 species)
  7. 62893Species Cow (Bos taurus) [TaxId:9913] [50981] (8 PDB entries)
  8. 62898Domain d2trcb_: 2trc B: [27653]
    Other proteins in same PDB: d2trcg_, d2trcp_

Details for d2trcb_

PDB Entry: 2trc (more details), 2.4 Å

PDB Description: phosducin/transducin beta-gamma complex

SCOP Domain Sequences for d2trcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2trcb_ b.69.4.1 (B:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus)}
mseldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiya
mhwgtdsrlllsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldni
csiynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttf
tghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngna
fatgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdal
kadragvlaghdnrvsclgvtddgmavatgswdsflkiwn

SCOP Domain Coordinates for d2trcb_:

Click to download the PDB-style file with coordinates for d2trcb_.
(The format of our PDB-style files is described here.)

Timeline for d2trcb_: