SCOPe 2.08: Domain d5bvjc1: 5bvj C:1-106

Lineage for d5bvjc1 (5bvj C:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5bvjc1: 5bvj C:1-106 [276524]
   Other proteins in same PDB: d5bvja2, d5bvjb_, d5bvjc2, d5bvjd_, d5bvje2, d5bvjf_, d5bvjg2, d5bvjh_
   automated match to d1dn0a1

Details for d5bvjc1

PDB Entry: 5bvj, 2 Å

PDB Description: the molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing il-1beta

PDB Compounds: (C:) canakinumab Fab light-chain

SCOPe Domain Sequences for d5bvjc1:

Sequence; same for both SEQRES and ATOM records:

>d5bvjc1 b.1.1.0 (C:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspdfqsvtpkekvtitcrasqsigsslhwyqqkpdqspkllikyasqsfsgvps
rfsgsgsgtdftltinsleaedaaayychqssslpftfgpgtkvdi

Timeline for d5bvjc1:

• d5bvjc1 first appeared in SCOPe 2.05
  
• d5bvjc1 appears in SCOPe 2.07