SCOPe 2.08: Domain d5bvjg2: 5bvj G:107-214

Lineage for d5bvjg2 (5bvj G:107-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5bvjg2: 5bvj G:107-214 [276521]
   Other proteins in same PDB: d5bvja1, d5bvjb_, d5bvjc1, d5bvjd_, d5bvje1, d5bvjf_, d5bvjg1, d5bvjh_
   automated match to d1dn0a2

Details for d5bvjg2

PDB Entry: 5bvj, 2 Å

PDB Description: the molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing il-1beta

PDB Compounds: (G:) canakinumab Fab light-chain

SCOPe Domain Sequences for d5bvjg2:

Sequence; same for both SEQRES and ATOM records:

>d5bvjg2 b.1.1.2 (G:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d5bvjg2:

• d5bvjg2 first appeared in SCOPe 2.05
  
• d5bvjg2 appears in SCOPe 2.07