Lineage for d5bvjg1 (5bvj G:1-106)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2356102Domain d5bvjg1: 5bvj G:1-106 [276520]
    Other proteins in same PDB: d5bvja2, d5bvjc2, d5bvje2, d5bvjg2
    automated match to d1dn0a1

Details for d5bvjg1

PDB Entry: 5bvj (more details), 2 Å

PDB Description: the molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing il-1beta
PDB Compounds: (G:) canakinumab Fab light-chain

SCOPe Domain Sequences for d5bvjg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bvjg1 b.1.1.0 (G:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspdfqsvtpkekvtitcrasqsigsslhwyqqkpdqspkllikyasqsfsgvps
rfsgsgsgtdftltinsleaedaaayychqssslpftfgpgtkvdi

SCOPe Domain Coordinates for d5bvjg1:

Click to download the PDB-style file with coordinates for d5bvjg1.
(The format of our PDB-style files is described here.)

Timeline for d5bvjg1: