SCOPe 2.07: Domain d5bxdb1: 5bxd B:29-130

Lineage for d5bxdb1 (5bxd B:29-130)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (53 PDB entries)

8. Domain d5bxdb1: 5bxd B:29-130 [276514]
   Other proteins in same PDB: d5bxdb2, d5bxdc2, d5bxdd2, d5bxde2
   automated match to d3kvta_

Details for d5bxdb1

PDB Entry: 5bxd, 1.8 Å

PDB Description: crystal structure of pentameric kctd1 btb domain form 2

PDB Compounds: (B:) BTB/POZ domain-containing protein KCTD1

SCOPe Domain Sequences for d5bxdb1:

Sequence; same for both SEQRES and ATOM records:

>d5bxdb1 d.42.1.0 (B:29-130) automated matches {Human (Homo sapiens) [TaxId: 9606]}
napvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfryil
nflrtskllipddfkdytllyeeakyfqlqpmllemerwkqd

Timeline for d5bxdb1:

• d5bxdb1 first appeared in SCOPe 2.05, called d5bxdb_
  
• d5bxdb1 appears in SCOPe 2.06
  
• d5bxdb1 appears in the current release, SCOPe 2.08