Lineage for d5bxbi1 (5bxb I:29-132)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945442Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2945443Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2945784Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2945785Protein automated matches [190710] (5 species)
    not a true protein
  7. 2945786Species Human (Homo sapiens) [TaxId:9606] [187857] (54 PDB entries)
  8. 2945844Domain d5bxbi1: 5bxb I:29-132 [276511]
    Other proteins in same PDB: d5bxba2, d5bxbb2, d5bxbc2, d5bxbd2, d5bxbe2, d5bxbf2, d5bxbg2, d5bxbh2, d5bxbi2, d5bxbj2
    automated match to d3kvta_

Details for d5bxbi1

PDB Entry: 5bxb (more details), 2.17 Å

PDB Description: crystal structure of pentameric kctd1 btb domain form 1
PDB Compounds: (I:) BTB/POZ domain-containing protein KCTD1

SCOPe Domain Sequences for d5bxbi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bxbi1 d.42.1.0 (I:29-132) automated matches {Human (Homo sapiens) [TaxId: 9606]}
napvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfryil
nflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdre

SCOPe Domain Coordinates for d5bxbi1:

Click to download the PDB-style file with coordinates for d5bxbi1.
(The format of our PDB-style files is described here.)

Timeline for d5bxbi1: