Lineage for d5bxbd1 (5bxb D:29-132)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2189359Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2189360Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2189641Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2189642Protein automated matches [190710] (3 species)
    not a true protein
  7. 2189643Species Human (Homo sapiens) [TaxId:9606] [187857] (39 PDB entries)
  8. 2189694Domain d5bxbd1: 5bxb D:29-132 [276506]
    Other proteins in same PDB: d5bxba2, d5bxbb2, d5bxbc2, d5bxbd2, d5bxbe2, d5bxbf2, d5bxbg2, d5bxbh2, d5bxbi2, d5bxbj2
    automated match to d3kvta_

Details for d5bxbd1

PDB Entry: 5bxb (more details), 2.17 Å

PDB Description: crystal structure of pentameric kctd1 btb domain form 1
PDB Compounds: (D:) BTB/POZ domain-containing protein KCTD1

SCOPe Domain Sequences for d5bxbd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bxbd1 d.42.1.0 (D:29-132) automated matches {Human (Homo sapiens) [TaxId: 9606]}
napvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfryil
nflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdre

SCOPe Domain Coordinates for d5bxbd1:

Click to download the PDB-style file with coordinates for d5bxbd1.
(The format of our PDB-style files is described here.)

Timeline for d5bxbd1: