Lineage for d5bvpi_ (5bvp I:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2053109Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2053419Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 protein domains)
  6. 2053447Protein Interleukin-1beta [50363] (2 species)
  7. 2053448Species Human (Homo sapiens) [TaxId:9606] [50364] (26 PDB entries)
    Uniprot P01584 117-269
  8. 2053470Domain d5bvpi_: 5bvp I: [276504]
    Other proteins in same PDB: d5bvpl1, d5bvpl2
    automated match to d1i1ba_
    complexed with cl

Details for d5bvpi_

PDB Entry: 5bvp (more details), 2.2 Å

PDB Description: the molecular mode of action and species specificity of canakinumab, a human monoclonal antibody neutralizing il-1beta
PDB Compounds: (I:) interleukin-1 beta

SCOPe Domain Sequences for d5bvpi_:

Sequence, based on SEQRES records: (download)

>d5bvpi_ b.42.1.2 (I:) Interleukin-1beta {Human (Homo sapiens) [TaxId: 9606]}
vrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipvalgl
keknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnwyi
stsqaenmpvflggtkggqditdftmqfvss

Sequence, based on observed residues (ATOM records): (download)

>d5bvpi_ b.42.1.2 (I:) Interleukin-1beta {Human (Homo sapiens) [TaxId: 9606]}
vrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipvalgl
keknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnwyi
stsqaenmpvflggggqditdftmqfvss

SCOPe Domain Coordinates for d5bvpi_:

Click to download the PDB-style file with coordinates for d5bvpi_.
(The format of our PDB-style files is described here.)

Timeline for d5bvpi_: