SCOPe 2.08: Domain d5bxba1: 5bxb A:29-132

Lineage for d5bxba1 (5bxb A:29-132)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (54 PDB entries)

8. Domain d5bxba1: 5bxb A:29-132 [276502]
   Other proteins in same PDB: d5bxba2, d5bxbb2, d5bxbc2, d5bxbd2, d5bxbe2, d5bxbf2, d5bxbg2, d5bxbh2, d5bxbi2, d5bxbj2
   automated match to d3kvta_

Details for d5bxba1

PDB Entry: 5bxb, 2.17 Å

PDB Description: crystal structure of pentameric kctd1 btb domain form 1

PDB Compounds: (A:) BTB/POZ domain-containing protein KCTD1

SCOPe Domain Sequences for d5bxba1:

Sequence; same for both SEQRES and ATOM records:

>d5bxba1 d.42.1.0 (A:29-132) automated matches {Human (Homo sapiens) [TaxId: 9606]}
napvhidvgghmytsslatltkypesrigrlfdgtepivldslkqhyfidrdgqmfryil
nflrtskllipddfkdytllyeeakyfqlqpmllemerwkqdre

Timeline for d5bxba1:

• d5bxba1 first appeared in SCOPe 2.05, called d5bxba_
  
• d5bxba1 appears in SCOPe 2.07