Lineage for d5brri_ (5brr I:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949015Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 1949016Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 1949017Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 1949133Protein Plasminogen activator inhibitor-1 [56587] (3 species)
  7. 1949134Species Human (Homo sapiens) [TaxId:9606] [56588] (15 PDB entries)
  8. 1949163Domain d5brri_: 5brr I: [276501]
    automated match to d1lj5a_
    complexed with gol, pge

Details for d5brri_

PDB Entry: 5brr (more details), 3.16 Å

PDB Description: michaelis complex of tpa-s195a:pai-1
PDB Compounds: (I:) Plasminogen activator inhibitor 1

SCOPe Domain Sequences for d5brri_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5brri_ e.1.1.1 (I:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]}
vahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfkid
dkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvdfs
everarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssthrr
lfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekevpl
saltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqadft
slsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvvrhnpt
gtvlfmgqvmep

SCOPe Domain Coordinates for d5brri_:

Click to download the PDB-style file with coordinates for d5brri_.
(The format of our PDB-style files is described here.)

Timeline for d5brri_: