| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.30: Cutinase-like [52260] (3 proteins) minimal alpha/beta hydrolase lacking peripheral secondary structures; similar to a flavodoxin-like fold automatically mapped to Pfam PF01083 |
| Protein automated matches [191066] (4 species) not a true protein |
| Species Fusarium oxysporum [TaxId:1089458] [276488] (1 PDB entry) |
| Domain d5ajhc_: 5ajh C: [276492] Other proteins in same PDB: d5ajha2, d5ajhb2 automated match to d2cuta_ complexed with mpd |
PDB Entry: 5ajh (more details), 1.9 Å
SCOPe Domain Sequences for d5ajhc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ajhc_ c.69.1.30 (C:) automated matches {Fusarium oxysporum [TaxId: 1089458]}
sitrndlangnsgscpgvifiyargstesgnlgtlgprvaskleakygkngvwiqgvgga
yratlgdnalprgtssaairemlghfsdanqkcpdavliaggysqgaalaaasvtdvdag
irekiagavlfgytknlqnrgkipsypedrtkvfcntgdlvctgslivaaphlayqsaas
gaapefliqkadaaga
Timeline for d5ajhc_:
View in 3DDomains from other chains: (mouse over for more information) d5ajha1, d5ajha2, d5ajhb1, d5ajhb2 |