Lineage for d5ajhc_ (5ajh C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901665Family c.69.1.30: Cutinase-like [52260] (3 proteins)
    minimal alpha/beta hydrolase lacking peripheral secondary structures; similar to a flavodoxin-like fold
    automatically mapped to Pfam PF01083
  6. 2901720Protein automated matches [191066] (4 species)
    not a true protein
  7. 2901721Species Fusarium oxysporum [TaxId:1089458] [276488] (1 PDB entry)
  8. 2901724Domain d5ajhc_: 5ajh C: [276492]
    Other proteins in same PDB: d5ajha2, d5ajhb2
    automated match to d2cuta_
    complexed with mpd

Details for d5ajhc_

PDB Entry: 5ajh (more details), 1.9 Å

PDB Description: crystal structure of fusarium oxysporum cutinase
PDB Compounds: (C:) cutinase

SCOPe Domain Sequences for d5ajhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ajhc_ c.69.1.30 (C:) automated matches {Fusarium oxysporum [TaxId: 1089458]}
sitrndlangnsgscpgvifiyargstesgnlgtlgprvaskleakygkngvwiqgvgga
yratlgdnalprgtssaairemlghfsdanqkcpdavliaggysqgaalaaasvtdvdag
irekiagavlfgytknlqnrgkipsypedrtkvfcntgdlvctgslivaaphlayqsaas
gaapefliqkadaaga

SCOPe Domain Coordinates for d5ajhc_:

Click to download the PDB-style file with coordinates for d5ajhc_.
(The format of our PDB-style files is described here.)

Timeline for d5ajhc_: