Lineage for d5ahea_ (5ahe A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079793Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2079794Protein automated matches [190292] (34 species)
    not a true protein
  7. 2079923Species Salmonella enterica [TaxId:28901] [276471] (19 PDB entries)
  8. 2079925Domain d5ahea_: 5ahe A: [276487]
    automated match to d4gj1a_
    complexed with epe, gol, na, po4

Details for d5ahea_

PDB Entry: 5ahe (more details), 1.7 Å

PDB Description: crystal structure of salmonella enterica hisa

SCOPe Domain Sequences for d5ahea_:

Sequence, based on SEQRES records: (download)

>d5ahea_ c.1.2.0 (A:) automated matches {Salmonella enterica [TaxId: 28901]}
miipaldlidgtvvrlhqgdyarqrdygndplprlqdyaaqgagvlhlvdltgakdpakr
qipliktlvagvnvpvqvgggvrteedvaallkagvarvvigstavkspdvvkgwferfg
aqalvlaldvridehgtkqvavsgwqensgvsleqlvetylpvglkhvlctdisrdgtla
gsnvslyeevcarypqiafqssggigdiddiaalrgtgvrgvivgrallegkftvkeaiq
cwqn

Sequence, based on observed residues (ATOM records): (download)

>d5ahea_ c.1.2.0 (A:) automated matches {Salmonella enterica [TaxId: 28901]}
miipaldlidgtvvrlqrdygndplprlqdyaaqgagvlhlvdltgakdpakrqiplikt
lvagvnvpvqvgggvrteedvaallkagvarvvigstavkspdvvkgwferfgaqalvla
ldvridehgtkqvavsgwqensgvsleqlvetylpvglkhvlctdisgsnvslyeevcar
ypqiafqssggigdiddiaalrgtgvrgvivgrallegkftvkeaiqcwqn

SCOPe Domain Coordinates for d5ahea_:

Click to download the PDB-style file with coordinates for d5ahea_.
(The format of our PDB-style files is described here.)

Timeline for d5ahea_: