Lineage for d5abvg1 (5abv G:69-248)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962641Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2962642Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2962762Family d.86.1.0: automated matches [191459] (1 protein)
    not a true family
  6. 2962763Protein automated matches [190708] (10 species)
    not a true protein
  7. 2962784Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [256194] (8 PDB entries)
  8. 2962790Domain d5abvg1: 5abv G:69-248 [276480]
    Other proteins in same PDB: d5abva2, d5abvc2, d5abve2, d5abvg2
    automated match to d2v8ye1

Details for d5abvg1

PDB Entry: 5abv (more details), 2.13 Å

PDB Description: complex of d. melanogaster eif4e with the 4e-binding protein mextli
PDB Compounds: (G:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d5abvg1:

Sequence, based on SEQRES records: (download)

>d5abvg1 d.86.1.0 (G:69-248) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
khplmnvwtlwylendrskswedmqneitsfdtvedfwslynhikppseiklgsdyslfk
knirpmwedaankqggrwvitlnkssktdldnlwldvllcligeafdhsdqicgavinir
gksnkisiwtadgnneeaaleighklrdalrlgrnnslqyqlhkdtmvkqgsnvksiytl

Sequence, based on observed residues (ATOM records): (download)

>d5abvg1 d.86.1.0 (G:69-248) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
khplmnvwtlwylendrskswedmqneitsfdtvedfwslynhikppseiklgsdyslfk
knirpmwedaankqggrwvitlnkssktdldnlwldvllcligeafdhsdqicgavinir
gksnkisiwtadgnneeaaleighklrdalrrnnslqyqlhkdtmvnvksiytl

SCOPe Domain Coordinates for d5abvg1:

Click to download the PDB-style file with coordinates for d5abvg1.
(The format of our PDB-style files is described here.)

Timeline for d5abvg1: