SCOPe 2.04: Domain d1gotb_: 1got B:

Lineage for d1gotb_ (1got B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.4: WD40 repeat-like [50978] (4 families)
   also contains 8-bladed propellers

5. Family b.69.4.1: WD40-repeat [50979] (11 proteins)
   this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain

6. Protein beta1-subunit of the signal-transducing G protein heterotrimer [50980] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50981] (20 PDB entries)

8. Domain d1gotb_: 1got B: [27648]
   Other proteins in same PDB: d1gota1, d1gota2, d1gotg_
   complexed with gdp

Details for d1gotb_

PDB Entry: 1got, 2 Å

PDB Description: heterotrimeric complex of a gt-alpha/gi-alpha chimera and the gt-beta-gamma subunits

PDB Compounds: (B:) gt-beta

SCOPe Domain Sequences for d1gotb_:

Sequence; same for both SEQRES and ATOM records:

>d1gotb_ b.69.4.1 (B:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}
seldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiyam
hwgtdsrlllsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldnic
siynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttft
ghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngnaf
atgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdalk
adragvlaghdnrvsclgvtddgmavatgswdsflkiwn

Timeline for d1gotb_:

• d1gotb_ first appeared (with stable ids) in SCOP 1.55
  
• d1gotb_ appears in SCOPe 2.03
  
• d1gotb_ appears in SCOPe 2.05
  
• d1gotb_ appears in the current release, SCOPe 2.08