Lineage for d1gotb_ (1got B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675262Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 675344Superfamily b.69.4: WD40 repeat-like [50978] (2 families) (S)
    also contains 8-bladed propellers
  5. 675345Family b.69.4.1: WD40-repeat [50979] (8 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 675375Protein beta1-subunit of the signal-transducing G protein heterotrimer [50980] (1 species)
  7. 675376Species Cow (Bos taurus) [TaxId:9913] [50981] (11 PDB entries)
  8. 675390Domain d1gotb_: 1got B: [27648]
    Other proteins in same PDB: d1gota1, d1gota2, d1gotg_
    complexed with gdp

Details for d1gotb_

PDB Entry: 1got (more details), 2 Å

PDB Description: heterotrimeric complex of a gt-alpha/gi-alpha chimera and the gt-beta-gamma subunits
PDB Compounds: (B:) gt-beta

SCOP Domain Sequences for d1gotb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gotb_ b.69.4.1 (B:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}
seldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiyam
hwgtdsrlllsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldnic
siynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttft
ghtgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngnaf
atgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdalk
adragvlaghdnrvsclgvtddgmavatgswdsflkiwn

SCOP Domain Coordinates for d1gotb_:

Click to download the PDB-style file with coordinates for d1gotb_.
(The format of our PDB-style files is described here.)

Timeline for d1gotb_: