Lineage for d5abxa_ (5abx A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569268Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2569269Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2569389Family d.86.1.0: automated matches [191459] (1 protein)
    not a true family
  6. 2569390Protein automated matches [190708] (10 species)
    not a true protein
  7. 2569437Species Nematode (Caenorhabditis elegans) [TaxId:6239] [276473] (2 PDB entries)
  8. 2569438Domain d5abxa_: 5abx A: [276477]
    automated match to d1l8bb_
    complexed with cl, mgp, zn

Details for d5abxa_

PDB Entry: 5abx (more details), 1.66 Å

PDB Description: complex of c. elegans eif4e-3 with the 4e-binding protein mextli and cap analog
PDB Compounds: (A:) eukaryotic translation initiation factor 4e-3

SCOPe Domain Sequences for d5abxa_:

Sequence, based on SEQRES records: (download)

>d5abxa_ d.86.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
trhplqnrwalwylkadrnkewedclkmvslfdtvedfwslynhiqsagglnwgsdyylf
kegikpmwedvnnvqggrwlvvvdkqklqrrtqlldhywlellmaivgeqfdeygdyicg
avvnvrqkgdkvslwtrdatrddvnlrigqvlkqklsipdteilryevhkdssartsstv
kpricl

Sequence, based on observed residues (ATOM records): (download)

>d5abxa_ d.86.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
trhplqnrwalwylkadrnkewedclkmvslfdtvedfwslynhiqsagglnwgsdyylf
kegikpmwedvnnvqggrwlvvvdtqlldhywlellmaivgeqfdeygdyicgavvnvrq
kgdkvslwtrdatrddvnlrigqvlkqklsipdteilryevhkdssakpricl

SCOPe Domain Coordinates for d5abxa_:

Click to download the PDB-style file with coordinates for d5abxa_.
(The format of our PDB-style files is described here.)

Timeline for d5abxa_: