Lineage for d5abya_ (5aby A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962641Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2962642Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2962762Family d.86.1.0: automated matches [191459] (1 protein)
    not a true family
  6. 2962763Protein automated matches [190708] (10 species)
    not a true protein
  7. 2962814Species Nematode (Caenorhabditis elegans) [TaxId:6239] [276473] (2 PDB entries)
  8. 2962816Domain d5abya_: 5aby A: [276475]
    Other proteins in same PDB: d5abyc2
    automated match to d1l8bb_
    complexed with gol, mg

Details for d5abya_

PDB Entry: 5aby (more details), 1.95 Å

PDB Description: complex of c. elegans eif4e-3 with the 4e-binding protein mextli
PDB Compounds: (A:) eukaryotic translation initiation factor 4e-3

SCOPe Domain Sequences for d5abya_:

Sequence, based on SEQRES records: (download)

>d5abya_ d.86.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
trhplqnrwalwylkadrnkewedclkmvslfdtvedfwslynhiqsagglnwgsdyylf
kegikpmwedvnnvqggrwlvvvdkqklqrrtqlldhywlellmaivgeqfdeygdyicg
avvnvrqkgdkvslwtrdatrddvnlrigqvlkqklsipdteilryevhkdssartsstv
kpricl

Sequence, based on observed residues (ATOM records): (download)

>d5abya_ d.86.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
trhplqnrwalwylkadrnkewedclkmvslfdtvedfwslynhiqsagglnwgsdyylf
kegikpmwedvnnvqggrwlvvvdkqklqrrtqlldhywlellmaivgeqfdeygdyicg
avvnvrqkgdkvslwtrdatrddvnlrigqvlkqklsipdteilryevhkdsskpricl

SCOPe Domain Coordinates for d5abya_:

Click to download the PDB-style file with coordinates for d5abya_.
(The format of our PDB-style files is described here.)

Timeline for d5abya_: