SCOPe 2.08: Domain d5abyc1: 5aby C:30-215

Lineage for d5abyc1 (5aby C:30-215)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.86: eIF4e-like [55417] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478

4. Superfamily d.86.1: eIF4e-like [55418] (3 families)

5. Family d.86.1.0: automated matches [191459] (1 protein)
   not a true family

6. Protein automated matches [190708] (10 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [276473] (2 PDB entries)

8. Domain d5abyc1: 5aby C:30-215 [276474]
   Other proteins in same PDB: d5abyc2
   automated match to d1l8bb_
   complexed with gol, mg

Details for d5abyc1

PDB Entry: 5aby, 1.95 Å

PDB Description: complex of c. elegans eif4e-3 with the 4e-binding protein mextli

PDB Compounds: (C:) eukaryotic translation initiation factor 4e-3

SCOPe Domain Sequences for d5abyc1:

Sequence, based on SEQRES records:

>d5abyc1 d.86.1.0 (C:30-215) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
trhplqnrwalwylkadrnkewedclkmvslfdtvedfwslynhiqsagglnwgsdyylf
kegikpmwedvnnvqggrwlvvvdkqklqrrtqlldhywlellmaivgeqfdeygdyicg
avvnvrqkgdkvslwtrdatrddvnlrigqvlkqklsipdteilryevhkdssartsstv
kpricl

Sequence, based on observed residues (ATOM records):

>d5abyc1 d.86.1.0 (C:30-215) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
trhplqnrwalwylkadrnkewedclkmvslfdtvedfwslynhiqsagglnwgsdyylf
kegikpmwedvnnvqggrwlvvvdkqklqrrtqlldhywlellmaivgeqfdeygdyicg
avvnvrqkgdkvslwtrdatrddvnlrigqvlkqklsipdteilryevhkdssvkpricl

Timeline for d5abyc1:

• d5abyc1 first appeared in SCOPe 2.05, called d5abyc_
  
• d5abyc1 appears in SCOPe 2.07