| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (92 species) not a true protein |
| Species Lactococcus lactis [TaxId:416870] [188710] (8 PDB entries) |
| Domain d4zzda_: 4zzd A: [276463] automated match to d3f8fa_ complexed with rbf |
PDB Entry: 4zzd (more details), 2.35 Å
SCOPe Domain Sequences for d4zzda_:
Sequence, based on SEQRES records: (download)
>d4zzda_ a.4.5.0 (A:) automated matches {Lactococcus lactis [TaxId: 416870]}
pkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekdgiis
sywgdesqggrrkyyrlteighenmrlafeswsrvdkiienlea
>d4zzda_ a.4.5.0 (A:) automated matches {Lactococcus lactis [TaxId: 416870]}
pkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekdgiis
sywgdrkyyrlteighenmrlafeswsrvdkiienlea
Timeline for d4zzda_: