Lineage for d1qnic2 (1qni C:10-450)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 960204Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 960275Superfamily b.69.3: Nitrous oxide reductase, N-terminal domain [50974] (1 family) (S)
  5. 960276Family b.69.3.1: Nitrous oxide reductase, N-terminal domain [50975] (1 protein)
  6. 960277Protein Nitrous oxide reductase, N-terminal domain [50976] (2 species)
  7. 960283Species Pseudomonas nautica [TaxId:2743] [50977] (1 PDB entry)
  8. 960286Domain d1qnic2: 1qni C:10-450 [27644]
    Other proteins in same PDB: d1qnia1, d1qnib1, d1qnic1, d1qnid1, d1qnie1, d1qnif1
    complexed with ca, cl, cua, cuz

Details for d1qnic2

PDB Entry: 1qni (more details), 2.4 Å

PDB Description: crystal structure of nitrous oxide reductase from pseudomonas nautica, at 2.4a resolution
PDB Compounds: (C:) nitrous-oxide reductase

SCOPe Domain Sequences for d1qnic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnic2 b.69.3.1 (C:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]}
ahvapgeldeyygfwsgghqgevrvlgvpsmrelmripvfnvdsatgwgitneskeilgg
dqqylngdchhphismtdgrydgkylfindkantrvarirldimktdkithipnvqaihg
lrlqkvpktnyvfcnaefvipqpndgtdfsldnsytmftaidaetmdvawqvivdgnldn
tdadytgkyatstcynseravdlagtmrndrdwvvvfnveriaaavkagnfktigdskvp
vvdgrgeseftryipvpknphglntspdgkyfiangklsptvsviaidklddlfedkiel
rdtivaepelglgplhttfdgrgnayttlfidsqvckwniadaikhyngdrvnyirqkld
vqyqpghnhasltesrdadgkwlvvlskfskdrflpvgplhpendqlidisgeemklvhd
gptyaephdcilvrrdqiktk

SCOPe Domain Coordinates for d1qnic2:

Click to download the PDB-style file with coordinates for d1qnic2.
(The format of our PDB-style files is described here.)

Timeline for d1qnic2: