Lineage for d4z74a1 (4z74 A:1-159)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2790734Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2790901Family b.40.5.0: automated matches [191399] (1 protein)
    not a true family
  6. 2790902Protein automated matches [190523] (12 species)
    not a true protein
  7. 2790955Species Mycobacterium tuberculosis [TaxId:83332] [225097] (8 PDB entries)
  8. 2790968Domain d4z74a1: 4z74 A:1-159 [276418]
    Other proteins in same PDB: d4z74a2, d4z74b2, d4z74c2, d4z74d2, d4z74e2, d4z74f2, d4z74g2, d4z74h2, d4z74i2, d4z74j2, d4z74k2, d4z74l2
    automated match to d1wcfa_
    complexed with ca, pop

Details for d4z74a1

PDB Entry: 4z74 (more details), 2.55 Å

PDB Description: crystal structure of inorganic pyrophosphatase from mycobacterium tuberculosis in complex with inorganic pyrophosphate
PDB Compounds: (A:) inorganic pyrophosphatase

SCOPe Domain Sequences for d4z74a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z74a1 b.40.5.0 (A:1-159) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mqfdvtieipkgqrnkyevdhetgrvrldrylytpmayptdygfiedtlgddgdpldalv
llpqpvfpgvlvaarpvgmfrmvdehggddkvlcvpagdprwdhvqdigdvpafeldaik
hffvhykdlepgkfvkaadwvdraeaeaevqrsverfka

SCOPe Domain Coordinates for d4z74a1:

Click to download the PDB-style file with coordinates for d4z74a1.
(The format of our PDB-style files is described here.)

Timeline for d4z74a1: