Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) |
Family b.40.5.0: automated matches [191399] (1 protein) not a true family |
Protein automated matches [190523] (12 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [225097] (8 PDB entries) |
Domain d4z74a1: 4z74 A:1-159 [276418] Other proteins in same PDB: d4z74a2, d4z74b2, d4z74c2, d4z74d2, d4z74e2, d4z74f2, d4z74g2, d4z74h2, d4z74i2, d4z74j2, d4z74k2, d4z74l2 automated match to d1wcfa_ complexed with ca, pop |
PDB Entry: 4z74 (more details), 2.55 Å
SCOPe Domain Sequences for d4z74a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z74a1 b.40.5.0 (A:1-159) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} mqfdvtieipkgqrnkyevdhetgrvrldrylytpmayptdygfiedtlgddgdpldalv llpqpvfpgvlvaarpvgmfrmvdehggddkvlcvpagdprwdhvqdigdvpafeldaik hffvhykdlepgkfvkaadwvdraeaeaevqrsverfka
Timeline for d4z74a1: