![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
![]() | Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins) duplication: consists of 2 similar domains with 2 repeats in each Similar to the Methylmalonyl-CoA epimerase dimer |
![]() | Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species) |
![]() | Species Brevibacterium fuscum [TaxId:47914] [89888] (17 PDB entries) |
![]() | Domain d4z6zd1: 4z6z D:4-147 [276414] automated match to d1q0oa1 complexed with 4sx, ca, cl, fe2, mpo, p6g, pg4 |
PDB Entry: 4z6z (more details), 1.52 Å
SCOPe Domain Sequences for d4z6zd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z6zd1 d.32.1.3 (D:4-147) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum [TaxId: 47914]} eipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefihhn lvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrvedplg fpyefffetthverlhmrydlysa
Timeline for d4z6zd1: