Lineage for d1maeh_ (1mae H:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1554689Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1554711Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) (S)
  5. 1554712Family b.69.2.1: Methylamine dehydrogenase, H-chain [50970] (1 protein)
    less regular propeller without notable sequence repeats; quinone cofactor is a tryptophan derivative in another subunit
    automatically mapped to Pfam PF06433

    this is a repeat family; one repeat unit is 1mg2 A:132-178 found in domain
  6. 1554713Protein Methylamine dehydrogenase, H-chain [50971] (2 species)
  7. Species Paracoccus versutus (Thiobacillus versutus) [TaxId:34007] [50973] (3 PDB entries)
  8. 1554731Domain d1maeh_: 1mae H: [27641]
    Other proteins in same PDB: d1mael_
    complexed with hdz

Details for d1maeh_

PDB Entry: 1mae (more details), 2.8 Å

PDB Description: The Active Site Structure of Methylamine Dehydrogenase: Hydrazines Identify C6 as the Reactive Site of the Tryptophan Derived Quinone Cofactor
PDB Compounds: (H:) methylamine dehydrogenase (heavy subunit)

SCOPe Domain Sequences for d1maeh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1maeh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]}
ssasaaaaaaaaalaagaadgptndeapgadgrrsyinlpahhsaiiqqwvldagsgsil
ghvnggflpnpvaahsgsefalastsfsriakgkrtdyvevfdpvtflpiadielpdapr
fdvgpyswmnantpnnadllffqfaagpavglvvqggssddqllssptcyhihpgapstf
yllcaqgglaktdhaggaagaglvgamltaaqnlltqpaqanksgrivwpvysgkilqad
isaagatnkapidalsggrkadtwrpggwqqvaylkssdgiylltseqsawklhaaakev
tsvtglvgqtssqislghdvdaisvaqdggpdlyalsagtevlhiydagagdqdqstvel
gsgpqvlsvmnea

SCOPe Domain Coordinates for d1maeh_:

Click to download the PDB-style file with coordinates for d1maeh_.
(The format of our PDB-style files is described here.)

Timeline for d1maeh_: